This is similar to the level {Selleck Anti-infection Compound Library|Selleck Antiinfection Compound Library|Selleck Anti-infection Compound Library|Selleck Antiinfection Compound Library|Selleckchem Anti-infection Compound Library|Selleckchem Antiinfection Compound Library|Selleckchem Anti-infection Compound Library|Selleckchem Antiinfection Compound Library|Anti-infection Compound Library|Antiinfection Compound Library|Anti-infection Compound Library|Antiinfection Compound Library|Anti-infection Compound Library|Antiinfection Compound Library|Anti-infection Compound Library|Antiinfection Compound Library|Anti-infection Compound Library|Antiinfection Compound Library|Anti-infection Compound Library|Antiinfection Compound Library|Anti-infection Compound Library|Antiinfection Compound Library|Anti-infection Compound Library|Antiinfection Compound Library|Anti-infection Compound Library|Antiinfection Compound Library|buy Anti-infection Compound Library|Anti-infection Compound Library ic50|Anti-infection Compound Library price|Anti-infection Compound Library cost|Anti-infection Compound Library solubility dmso|Anti-infection Compound Library purchase|Anti-infection Compound Library manufacturer|Anti-infection Compound Library research buy|Anti-infection Compound Library order|Anti-infection Compound Library mouse|Anti-infection Compound Library chemical structure|Anti-infection Compound Library mw|Anti-infection Compound Library molecular weight|Anti-infection Compound Library datasheet|Anti-infection Compound Library supplier|Anti-infection Compound Library in vitro|Anti-infection Compound Library cell line|Anti-infection Compound Library concentration|Anti-infection Compound Library nmr|Anti-infection Compound Library in vivo|Anti-infection Compound Library clinical trial|Anti-infection Compound Library cell assay|Anti-infection Compound Library screening|Anti-infection Compound Library high throughput|buy Antiinfection Compound Library|Antiinfection Compound Library ic50|Antiinfection Compound Library price|Antiinfection Compound Library cost|Antiinfection Compound Library solubility dmso|Antiinfection Compound Library purchase|Antiinfection Compound Library manufacturer|Antiinfection Compound Library research buy|Antiinfection Compound Library order|Antiinfection Compound Library chemical structure|Antiinfection Compound Library datasheet|Antiinfection Compound Library supplier|Antiinfection Compound Library in vitro|Antiinfection Compound Library cell line|Antiinfection Compound Library concentration|Antiinfection Compound Library clinical trial|Antiinfection Compound Library cell assay|Antiinfection Compound Library screening|Antiinfection Compound Library high throughput|Anti-infection Compound high throughput screening| of LL-37 reported in human plasma (1.18 μg/ml) [27], suggesting that this is a physiologically relevant potency of LL-37. Table 1 Peptides used in this study Antimicrobial Peptides Sequence Net charge Ferroptosis inhibitor NA-CATH KR F KKFFKK L KNSVKKR A KKFFKK P KVIGVTFPF 15 NA-CATH-ATRA1-ATRA1 KR F KKFFKK L KNSVKKR F KKFFK K LKVIGVTFPF 15 ATRA-1 KRFKKFFKKLK-NH2 8 ATRA-2 KRAKKFFKKPK-NH2 8 ATRA-1A KRAKKFFKKLK-NH2 8 LL-37 [LL-37, 37 aa]

6 D-LL-37 [LL-37, 37 aa] 6 Scrambled LL-37 GLKLRFEFSKIKGEFLKTPEVRFRDIKLKDNRISVQR 6 This table indicates the Sequence and charges of the antimicrobial peptides used. Percent (%) survival was calculated by counting CFUs, after 3 hr incubations with various peptide concentrations Temsirolimus concentration in 10 mM sodium phosphate buffer (pH 7.4). a, The EC50s were found to be 2.9 μg/ml for NA-CATH and 1.3 μg/ml for LL-37. b, EC50s were found to be 0.51 μg/ml for NA-CATH:ATRA1-ATRA1 and 2.9 μg/ml for NA-CATH. c, EC50s were found

to be 0.51 μg/ml for NA-CATH:ATRA1-ATRA1 and 1.3 μg/ml for LL-37. d, EC50s were found to be 0.52 μg/ml for ATRA-1 and 18 μg/ml for ATRA-2. e, EC50s were found to be 13 μg/ml for D-LL-37 and 1.3 μg/ml for LL-37. f, EC50s were found to be 0.73 μg/ml for ATRA-1A and 0.52 μg/ml for ATRA-1. Curves were fit to the data, and R2 values were as follows: 0.97 for NA-CATH:ATRA1-ATRA1; 0.98 for NA-CATH; 0.95 for LL-37; 0.95 for D-LL-37;

0.98 for ATRA-1; 0.96 for ATRA-2; 0.96 for ATRA-1A. Table 2 EC50s of AMPs against S. aureus Antimicrobial Peptides Molecular weight (g/mol) EC50 (μg/ml) 95% CI EC50 (μM) NA-CATH 5885.50 2.85 1.22-6.69 0.48 NA-CATH-ATRA1-ATRA1 5977.60 0.51 0.25-1.01 0.09 ATRA-1 2409.06 0.52 0.25-1.11 0.22 ATRA-2 2316.96 18.0 7.67-41.8 7.77 ATRA-1A 2332.96 0.73 0.33-1.62 0.31 LL-37 5177.42 1.27 0.44-3.72 0.25 D-LL-37 5177.42 12.7 6.48-24.9 2.45 This table indicates the EC50 of the peptides against S. aureus in an anti-microbial assay. (*) The molecular weight ADAMTS5 reported here for each peptide reflects the TFA salts of the peptides. These molecular weights were then used to convert the EC50 in μg/ml to μM, to enable comparisons on a molecule by molecule basis. b. Synthetic peptides demonstrate anti-microbial activity against S. aureus S. aureus was also subjected to treatment with four synthetic peptides (Table 1), ATRA-1, ATRA-2, ATRA-1A, and NA-CATH:ATRA1-ATRA1, which represent variations on the ATRA-repeated motif of NA-CATH. The two ATRA peptides, ATRA-1 and ATRA-2, differ by two residues at the 3rd (F/A) and 10th (L/P) position.